PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018788-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 83aa    MW: 9858.53 Da    PI: 9.4657
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018788-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++++++G g W +++ + g++R++k c++rw++yl
    NNU_018788-RA  9 KGAWTEEEDILLRKCIERYGEGEWCKVPLRAGLNRCRKRCRLRWLNYL 56
                     79*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.724160IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-21759IPR009057Homeodomain-like
SMARTSM007172.5E-13858IPR001005SANT/Myb domain
PfamPF002492.6E-15956IPR001005SANT/Myb domain
SuperFamilySSF466899.9E-211083IPR009057Homeodomain-like
CDDcd001677.95E-101156No hitNo description
Gene3DG3DSA:1.10.10.601.6E-66083IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MDCGLGLRKG AWTEEEDILL RKCIERYGEG EWCKVPLRAG LNRCRKRCRL RWLNYLRPGI  60
NRGQFTSDEV DLIIWLHKLL GNR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274761.18e-47PREDICTED: myb-related protein 330-like
SwissprotQ9FNV94e-38MY113_ARATH; Transcription factor MYB113
TrEMBLA0A061ENQ74e-41A0A061ENQ7_THECC; R2R3 MYB transcription factor splice variant 1
TrEMBLU5GFP34e-41U5GFP3_POPTR; Uncharacterized protein
STRINGPOPTR_0005s14470.11e-40(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-39myb domain protein 113